PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_004178-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB_related
Protein Properties Length: 376aa    MW: 42680.2 Da    PI: 9.8691
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_004178-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.62.5e-071146238
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlk 38
                      rW t+E+++l  av ++G ++W++++ +++ +Rtl+
  AHYPO_004178-RA 11 VRWGTWEELILGGAVLRHGFHDWDSVSLELQ-TRTLY 46
                     69*****************************.***97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.920.106.9E-17225339IPR001487Bromodomain
SuperFamilySSF473705.36E-19227335IPR001487Bromodomain
SMARTSM002973.2E-17231335IPR001487Bromodomain
PfamPF004395.3E-13240319IPR001487Bromodomain
PROSITE profilePS5001410.87246316IPR001487Bromodomain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MVEERGGNYT VRWGTWEELI LGGAVLRHGF HDWDSVSLEL QTRTLYPYLF TPKVCKAKYE  60
VMQERYSGCS AWVEELRRKR VNELRRDLAK SEESIGSLES KLQTLKSEKA VCNYSDQGSS  120
AAESSGKAAS RDGSSAGSFT RVAQTNRVLQ CRIVDTEAAE DSYIKHVVLV SSLSLEKFPS  180
IGVNIRRRRG NRRRKDSNKE GNEGHDQNLG TSKQTRPVSL FDTNGPKQSS SKQGMDDFIK  240
IFDFVTQNEH AAVFRRRLDS QKRGRYKRII RRHIDLDTIK SKIANKCITS TVELLRDLLL  300
LANNALVFYS KNTREYKCAS LLRDLSTTIL HQHYKATNNR GCCSGCRDPK ITSVETTRKT  360
EKCSTLQPQV SQEDY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010696581.11e-133PREDICTED: uncharacterized protein LOC104909087 isoform X1
TrEMBLA0A0J8BA491e-133A0A0J8BA49_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60110.18e-18DNA-binding bromodomain-containing protein